ELF@4#4 (444JJLLL /lib/ld-linux.so.2GNUCG63;% ,/$27:&)E">*5?+-!C'D 0B(A9 <4@ #18 F.= $$"+)2D9ԍ"@XJDQ4Rc>joq="z"č3"R""T"PtwĎ7"$:ԏ$$1Ԏ"#" ="T"L!@"HԐQ4/"V4$]Ab"jdx:7"d"$ďHdĐ";":"$yDYt6t="T!.g5";DBp"K@[t"q7"wT"TL__gmon_start__libm.so.6libc.so.6strcpyprintfstdoutungetc__ctype_bgetenv__strtol_internalmemcpyperrorreadlinkputsfeofmalloc__finitefreaddirfflush__ctype_toupperputenvpipe__lxstatstrrchrfprintfstrcat__deregister_frame_info__finitewaitstrstrreadstrncmpstrncpyprogram_invocation_short_namerealloc_IO_getcforksscanftimeopendir__assert_failstrcmpdupgetcwdgetpwnamsprintffclosestderrfputcfwriteaccess__xstat__errno_locationexitfopen_IO_putc_IO_stdin_used_exit__libc_start_mainopenprogram_invocation_namestrchrfputsexecvpclosedir__ctype_tolower__register_frame_infoclose__finitelfree__progname_full__prognameGLIBC_2.1GLIBC_2.0 ii ii ii @@DH.LFPXTE < A(B #ĠȠ̠'РԠ3ؠ1ܠ 2%=> /9!  $-(,?0&4:8+<4@$D6HDL*P8TX5\)`,d0h"lptx|US[#t7]5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%ĠhP@%ȠhX0%̠h` %Рhh%Ԡhp%ؠhx%ܠh%h%h%h%h%h%h%hp%h`%hP%h@%h0% h %h%h%h%h% h%$h%(h%,h %0h(%4h0%8h8p%<h@`%@hHP%DhP@%HhX0%Lh` %Phh%Thp%Xhx%\h%`h%dh%hh%lh%ph%th%xhp%|h`1^PTRhYhdQVhU=Tu8PPСP8uԎt h|*TÉUÍvUth\h| ÍvUÐUVSEU H   `= `T\ hh, fB=X\  1۾ t&PhYVB C~] HJy\ \ \ \ \ \ \ \ @\ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \  *=F t5hYhZ M''@e[^UE@);Et1PRu t%UE@ `ÐUÍvUS] B;`vh Zn@ f   ]UWVS]=P;=duhZ'@=P<Pt'DC H@@<fLe[^_ÉUWV}t;Hfx w.@` H`@h<"P5P@v <e^_ÐUS=P@g@;<u&LأjZ=t*f@=$u*ft$ftf t5 Pt&fw P@f @ٍ[‰t thfOu , `t Pt&fhZA P5h(Z; ~ ffLh]UWVS5 j 0!  Q,E}+M M9ug=G t^h*Z0! 0Mb]}+M)ύ<9uSh,ZW5D0! e[^_UVS 0!  0PTD `C  H`@h<fL=huf{u3X\ 9 uQh@Z=X\ 9 u=G tZh A hZZF=G t'hZAh A hZ25Df{t &=P@wX\ P\ ; TP\ H P\ ph] 35 vhZh] Zv uh] hZO;h] hZ5D& 0! 0PTP\ DP H@B< @vt&=P@w 9P\ =F t hZe[^ÍvUVSj| h=T\ hhv fz=@B<hZhZ5 $  f@@9u f =$u)ft#ftf t5 Pfw Prt&ƒf@f'w£hCt&fOwhZh[z9+t&ffLhQ@ <9 t r5 ;T\ j`e[^ÐUVSE؍C=l$H[ t"=$t5 j  u =$u5 j\=$"=$u5 j N 0 9u;|5 P#E PhZ5  C9r/t&~ Ph)[} Ph1[= t@ t&@f@@f@%Ph9[5 J@@@У@ 0  9s2<\t<"u5 j\ 5 PC9rhE[hZ5 t&5 j+5 j+f5 j-5 j-F5 j-5 j>&5 j>g5 j>5 j=G5 j=5 j<'5 j<5 j>5 j=5 j<5 j=5 j!5 j=f5 j&5 j&F5 j|5 j|&5 j.g5 j.Z5 j.5 j:@5 j:5 j.&5 j*t&5 j-5 j>5 j*5 S5 j $t&$<u $i<u5 j =$tF$D5 j/$.=$u5 j ^5 SO$e[^ÐU9vW%uY@@:@tJ B<@u;wJ B\ J uz>u%ÐUSMv;v8$tlvhP]1dt&t<*u:/u B<<@u\ tZvh]>1 l1]ÍvUWVSv 9[=pty\t p#u =g=ZhF=DG t \\ @ 0!   \\ \\ 1эL 9=DG t ,! 50!  Pj595\\ (Á   ; `uh Z*2  } ; `uh Z1   lu/u@B<*th ^*svhJ^~* t&hh^h^G*&@`\ 9v t@u*Z>tˊ\ ttG@r5B;=XsGXDH t |  uO;=XrIh^5Dw5Djjhh]=u ? u vO-~%jh]GP ujGP jWhg&9 =`\ (ul P\ X\ 9s 9P\ 9 tCP\ 9rX\ 9P\ u- 9vr5 9B h^*A\\ @@@>:@uz>t#5uF5UBEx@uz>u݋;rh^(9h]'Hv\\ :\ur5z'u:'tV:@u%z@th _' Br5; `B<'uBt& t4|0=p9  #u= u pW߃[$L_:+t9a Yt& -u#93+>y*u(A99 *u9.y.q59qit&::T9A9t&:=$9 t& =u#9>9 =u9\F\\ ~_ЃwRߊA<V\\ F|ЊVЀF\\ v|t&OރVt$a pv cS C 3 #? \\ QXEDPt#y|Q\\ AǃЉ:&FDCt(y|"Q\\ APh ^hce[^_ÉUhch - Phch T\ -`Ph dh_( -@ PhDdw(h -=Ph\dZÐU@ (   0 0  E ` = ` r E  E  9 E v( hii 0oxG F F = u"hnih A QP u1h A  hnih /P uh hpi$ÉUWVS}Wuu v t'؈F< t5;5wWRÃu;5v0W:Ãt% tWS$ hiu= u 1 &e[^_ÍvU @ v,! 5 /= r؀= @u XDPt= |@  xt*<viu hiq,! 5 u hi8  tθ@  ʉ  QRh PÉUWVS1 @ - 9Rh@ h . @ @ @! <!  XDB t8|p5@DB u 9@u&QXDP ty}y*u @ =@ u@ DG ,! 5 6u#hiM @ DG  = @  XDHt= |@ & t& 1IwRh@ <5 ^0!  ,! $E DG =DG EDG      }ÐUWS=DG $E 90! ,! 5 u%hj  @ z  H=@ !  XDB t 9|AIDJ u 9@u&QXDP ty}y*u @ =@ t@ @! @  = @ XDPt= |@  <w( hjx 8 zu$=DG EDG =DG t$E 90! 0! E  M0! z4)H 0! =DG t $E 90! t'0! E0! 48ƒt DG uK= u>  -@ 9u!@ 8 u@ v DG t$E 90! I= t1  = @ it I "E@EP t t ; r hk0! ~h9kpt&B0!  Ӂ  <"u=Aǀy"t9wB=?"u;=uES@< t4< t0<"t,9w*B t t"u9v 0! hTkjj+0!   P+‰  hjRE0!  td 1I w"S  P5 70! 8: 0! hqk e[_U =@ tT-@ @Ph@ h   -@  DG 0! $E hkÍvU WVSM UUuM9t A9u+}UBU9saUXE9Mr4` UUt&[tURWURSjt ` C`   9( ;vhk  ; r hkWUR5(   U ( ( UB= u EPS؍e[^_UWVSE0x= tj@Xx u,9r(5D5D)SjVp+t&5D5DF)SjVE 10= ut5D5Djjhke[^_ÍvUWVSu ~} tHFPx u9r}wu t&B )SQ}Wo ߉} u}e[^_ÍvUWVS}p@5D5DSjVXރ;ws5D5Djjhk/e[^_ÍvUVSUM] u8u AB9s9r9u9u,%v9u t&8| v1e[^ÍvUWVS5 ME+EM};=vhkL B;rhk. J  =( z}t&@ K @ J  ( B؅}XSMQMQ FFV}u5( } uMqMqe[^_ÉUWVS]E+E M< ;rhkL ËC= uS 0@ 7;v hk H  ( XWM QV}t ( @ e[^_ÍvUWVS1ҋ( E1EE +ExthRPPWuƒtuu]u[[ދ^NMu]Euu"MQE @PuRMQ&VWMQ ttMtj}u h lS9}H}tM 9MwxMQE @PuVdh'lHhkzShkjVhl ,h@lIVhdl9Vhle[^_ÍvU WVSuUU^>}FHx u;r E[ EA +uVUR} WURtt3g u}tu}7JC9u ?6}u)u t)u UYU}e[^_ÍvUWVSEP8!u |llP=&=DG t$E 90! u5,! hl0! u5 hlʼ  P4 hl証 9sƁ v\ 9s&; u 5Dj 5DPC9r5Dj 9s5Dj ԼC9rt&5DP赼C9r8|u5Dj|薼5Dj 膼5D舺e[^_ÉU5Dj T= G tt%t<tt#0=F t&hlhlh mh`mZ1ÐUE8t P3u UP蓻vUuhmhfhfÍvUWVSEEERt& X X]-t +s]{fE辿m߹1t Emtm߹u+j= u tP ]]uǹ tmǹ u.jhm= unnP  ]]8-u1 t&]xdu]h4h;nP1 tB= uh@n5Hhlnt&hn5Hhn px@E  ]ً1'<.u ֍Vt&UBB drUrg2UBtW`e[^_UWVSU}E} tЍG ЍG E_t7M4vEVM1onMM\_u֋MMe[^_ÍvUWVSEE߁`G G uu VheEPeEG ǃG j%l‰G G M G  u.vG0HO0Pw4m‰W4G0\^u΋W0G4}t"Mtj<1%PMQ, MQԮe[^_UWVS]1QkkƉٻt/tt!u y!u:؈AG„ue[^_ÉUWVS}}eUUdG 22g$]`G 3rjhrhrhrhrPjhrjWǃG jhrhrhrh shsh#sh*sh8shAsW]`G 3r,jhrhrhIshPsh`sPjhrEvjhrhrhrh shsh#sh*sh8shAsW_]`G 3s,jhrhrhsPǃG  jhsW]`G 3 rjhrhshsP` jhtjW:ǃG 7 E`G 0tjhrhth#tPjh@tL jhEtWw]`G 3NtjhSth\thdtP jh{tjW ]`G 3tjhththtPjht9t&E`G 0tjhthtPHjhtE`G 0tjhthuPjhu]`G 3ujhuhuPjhuhujW$dG 5dG p jhEtW&]`G 3ujhSthuhdtPt jhujWNjh@thuhuhuhuhuhuhuhvhvhvhvhvhvh%vh*vjWǃG \ E`G 00vjhrh4vh@vPjh]v &jhEtW']`G 3bvjhSthfvhdtPu jhmvjWOVjhrvWE`G 0rjhzvhvP)jhvE`G 0vjhvhwPjhwkE`G 0wjhSth#whdtPjh*wvE`G 00wjh3wh5HhlG `G EPh5H5H3 EPE1эqG t`U}t&EEtB1I19r"U9t)REP^…؉]Et}ubEE G tQUEEtB1I19r"U9t)REP…؉]Et1jUE}EE G UEPEPNjE|=tE}|ѡXDP t]){WPESVP };E|$Xt&}?Dz t EE}=u*E}?|XEDB t E}?}U1эYt$||5XT DF t JKt:}CPOƃS}WV7 3>tt&:;u:B:u}t)EPhr}WWƒEP轒]V}Wht,e[^_UWVSj0ÍEhPEUtxhtSd-E\ƃ>H&h~6ME1эy|;L t&XDP IO9}|;\EPd!D;uF5HhZ6h5Hh5Hh85H} 't&RSMSe1эy mS/S=EP Ã6EPM6 >EPe[^_ÉUWVS}=$t 1v=xu$$Tu hhhh蛎&PhrWVt xQRBVZuWt xQRà t 3S.1e[^_UWVSu1эY} QLǃVW貐E PSe[^_ÐUWVS]u 1щMщM})UEMDP5LǃSW=VW裎MQW虎e[^_ÐUWVSEu10PMǃuPWW߃ Fue[^_ÐUEx/uPt /tj.@P*u1ÍvUWVSEEE} 1эyWR?KE1hE Pl E WU REP茎 U}(1эytZ|;:uSjSMtDSu,D;/;.uSREP SLEH1EAt& t7t3.uKt'.u{tVSpLQUR}E S葍EP!Ã5U REPoI}5HhU Rh5H 5Hh"ڋ5H 5Hh輋5Hh@謋5Hh"蜋5HEEPKQh5 45HhrNUREPURE Ph5HN 5Hp5Hhr 5Hh5HBjURRPb5H#EP}ʉȍe[^_ÍvUVS=|t'uJVFSJVPh|Oe[^UWVS]u 1XtX8tL/uO9sK~/uEt&F/tuSuOt%{/u:u VSCu2 CF uu">u/u /tC u%e[^_ÉUVSMU 1BA8uÄu tte[^ÍvU WVSEhE P EvU %#քt|XvDC t Ft}C t|ѡXDP tC t|=XDG t C t}1t3t$VHQSHQUREEPURsE45Hhr\EPU Rh5Hd5H艇5Hhr&5Hhф5H[jURRP{5H<t&E PUR+E}%e[^_ÍvUWVS1j Eh(Q$ljEhw>PEU|t.t(Ph|t3蠈u҅u5|臈|Wt1hMQd#ljEhPzEUt4t(Ph;t3u҅u5We[^_U4WVSEE=|j/UR-EtPM9tI)΍^SKDẼV}WR謇 MDQh} WEUBU M M1ۃ}u2;s}W4EԃCt܃}u1q=tUR QRE؃ }ujCEM؉M9t CE}?uPUR"EE؉]̃t$M؍tt&MuU}؉E}M MЅQ| QREEjBE܍EP"/UM}܉O}$}1U MQPË}WSƃ4 t15HhrpVWSh5H}5H袃 ESv-t]QSxu؃U؃zt96M18S<- t] S>>t}tɃ}t,}WUR*.}uE t&SE}u }}tM9t QӄE}_}W蹄U 9Ut MQ襄E܍e[^_ÉU8WVS1=|n1;sU R4ACt߅u1@EEMЋ}EjRCj/MQ萃EtV}9tO)^S@EȃVWR MDQh} WEUBUMQ赃} }=tUR QRjEԃ E}uj*@EMԉM9t CE}?uPURAEԃt)Mԍ4DEȉ}ȋ}KuMUԉ U}}?}̅W| QREEjw?E؍EP+UM}؉O}-}:UMQPMË}WSƃ4 t15HhrVWSh5H5H% ES)t]TSuԃUԃztt}tɃ}t,}WUR*}uE t&S~E}u }}tM9t QSE}V}W9U 9Ut MQ%EЃ}E؍e[^_ÐUWVS}u VW1Ã4t/5HhSVWh 5H~5H~؍e[^_ÉUVSuV Ã4t-5Hh,SVh#5H:~5H_~؍e[^ÐUVSu9S3ƃ9tS0e[^ÍvUWVS]h8}ǃuj<SÃujS>u !u{!u hASt&.u;SuhAWVƃ :/ujhACPWV9ƃjhAShCWVƃEPRjTÃ\1De[^_ÉU,WVSEURPEUEUj;E1MUU9vE@4kƋUUtE@ tQV<|tSqS~hAVUREEPg~Va~GM9u19tUR4B~G;}uEP)}1ыUD Ee[^_ÉUWVSuG7Ej:EEPƒ t>t&uRhASVES}V}jƒuNj}1эQtEDEPt}EPGÃ;]t EPX}؍e[^_ÉUWVS]j9ESP-ƒ :!u z!uR?ƒtrtlUE1эYuhARVƃEED: RV]ED:W|E@Euj ƒ]}tEDe[^_ÐUWVSu ]EP<%UMUM)CP8ǃSVWL| ;WEP%UMQRMQ%e[^_ÉUDWVSu EP$EUEUEP$EUEUE̍MM]]8:ϊ}-:t,uLP6MQ%M]SQ]S$}W3&MAEPP$E؋U܉EUE{P6]SE̍UЍEPR(EЋUԉEĉURP}W$EP%Ẽ 8}tI5HhEy6hO5Hx5Hh_ky5Hx E̍@E%$u x{uÈ8}tHM̉Ȁ8}uX]̉؀8P6MQM]SQ]S#EP%ẺEUMQȍe[^_UWVSMt|XDB t At}ϊAt|СXDP t)CP{6ƃSWVy3e[^_UWVSEhEP"5E&uj%VxƒuhVx…tEt'|%Xt&EDB tEEt}EPE1ыELQÃuuR5HhfwEPEPh5Hnv5Hhׅ>w 5Hvt&jS5ǃ tW9tVWJxKt&5HhvSEPEPh5Hu5Hhׅv$5HuSwEPwtu\5HhvEPEPEPh 5Hu5HhׅTv$5HuEPwEPShU EPiwEPƃEPEPG3e[^_ÍvUSj hPPÍEhP2EU PJu]ÐUWVS]SY:ǃ=uS QRƃ u/t'S?S QR]Suvt t>tW39;ue[^_UWVS]u }1ɀ?tH1G?uȍe[^_ÉUWVS]u }1ɀ?tH1G?uȍe[^_UVSu] P|219sB;r론Ve[^vUWVS] SuvVSj 2] uqA]u ‹BuJe[^_UWVS] SuvVSj 1] uqA]u t&‹BuJe[^_UWVS} WMIQR`E1UM tct2t,PWru}tCtPURqt ދ[ut tCFM CUS*te[^_ÉUWVS]u MQVSǍEPEUEU؋ }t0}t#tPMQjqu sW[uЃt jW45Hh`2rMQhh5H>q5HcqGu5Hh{q_vÃ;tH5Hj s=8t3h5Hp 5H3q;u5Hj r5HpGe[^_ÍvU WVSEEEU;U EM<E}uQh5HBp _t t&F[u}uVh5Hp u}u5ts3h5Ho[u5Hj qEU;U S}tE1RP,$E1RP,$$MQU1u PMQu h5Hloe[^_UWVS} uhj)hho}uE }:u%u E t&}WE PU1эQE|:u} WPEEtw}:u:t EEutQ] 1Qw-ƃ]+]CP}WVp DE PVo}GWVo EP>/Ɖe[^_ÐUWVSK1jK -ƃ!t& t-3C9u{KWV.ƃURpt3 u΃t)3 u(UR{p tURPim vVo1e[^_ÐUWVSEu uDu1DÉ1Ҋt*ut<:u!u ~!u1V9)=HuMQVU R_ 1ۅtTt }tJ{uDV\)ƃt5>t0}u jt#ÃMQU RVWUMK t7Ct0}tKQRMQ 0URuEj`ƃ}]t}tMA|tjUR0=HtH4 t5HhSdM 1h 5Hc5Hc] U zt*t&5Hj d5H3Jd;u5Hh/dUMQR4 t 5Hj FeMAe[^_USjuu uxP,e؋]ÐUSjuu uPe؋]ÐUjju u2Ujju uzÐUVSu] hSV b }Vpbjydt&e[^ÐUWVS}?tt&>/u9uF>u)SWhdƃ²v2u.òp)S҅uP҅u²1IvDэQu#H҅uH҅ut)DžPha7=X€t  B:u1P1t%Pхu Pt 4RP1~IwFSхtMuIv=u9²6)ƒv$u ò7)Sхut 4 RhPhv[^P1t'Pхu Pt 4 t&RhPh8[1u/u f/1t'th4PZPPZPP-\1@t[^_ÍvUWVSuu Q҅uSu>_tjQ҅uCP҅uSuP>u0WWZt1эYt_T:/u vOJJKuC1эQSt |/uU4RVà >t V@ZjPÃ1эQt |/uDe[^_UXWVS1jURtURǃkhWPtT]8upURh4Pƃ SVjX uEIt%=@tjwtuURh4hpǃ WPPRW.Y؍e[^_UWVShWtjj jPW 45TVhVShSWhˆ$VXSXWX } tM QK5Lƒt/uBu BuBu 5L 5L T5ThՈ*e[^_ÉUjuÐUXVSuV+jV;V u&EPVjxV uE%=@toU$uEV( jSU u"EPSj/V uE%=@u*9t$SW uhވuV!U1ۉ؍e[^ÐUWVS}Wt!X)CPƃSWVSW3e[^_ÐUE11ɉHUVS]u H PsJ‰Ste[^U WVSu }UUUPr UB19s"}MًURUUUC9re[^_ÉU WVS}  U2uIM E PUB1ۃ;u u4NjMA<C;] uu PEE1UM;M tT19tFUMU4&EM4UB4mECM9uG;} u19tUB4^UCM;uUrHUMU MJe[^_ÉUS]Ct PUC]ÐUVSu] j @@tQtu t&Ae[^ÉUWVS}] {uC1ɋzt ыQzu9t#s9Zt@9XupSuYCe[^_ÐUWVS]hm ƒteuBu BuBu>tпt#RtSPQtju1e[^_ÐULWVShQh Qǃtjj jSpRt&1tjj jWRR &1ۅtuhj6h.h9TQEPSV }wS1RPhOMbω}e)}E)vRt.Q)1PW1QPhX]SSv1PW1QPhk&QS1RPhy]SRHv}؉EljREEPQh]SRSh e[^_UVSEu v !!d=`h Ãt<1u t&t<0u1ۅthljSd d=duHhɉt.ShՉhɉPhljSSd=dtdSh5HO dtGP6O^~t&5dj P5d3O;u5dj Pe[^ÍvU WVS=`uLh5HN] ;t!t&3h%5HbN ;u5Hj Ojh)Pƃ}h@NmWN}hfM^jh)OÃ}hM$M…}7hMSMMwMVzM_MtjQMVOVEM tj5MwOw%M t"=`tj MSOSLE P00Nƒt E 0LjCOVLwLSLh ƃt)|ˡXDHt P؈B:u׉e[^ÐUWVS}Tuhj%hϋhڋGPhWعVGVIt;u$5ThW諹V[GVcIt;u WAGÃt;u WMÃt SzÃ4@t;5HhG؅uPWh5HF5HF؍e[^_ÍvUWVSu} 15t&<t%t!V4LFu|LCh9rƍH hP5V'Ëh\|e[^_ÉUVSu1;hs7<t#tV4EuDt&C;hr1e[^ÉUWVS] E)؉FPEVSPG EPqƒtH5HhLFEPh 5HXE5HhW(F5HmEt&5ThEP舷V8EV@Gt;uEPEÃt;uEP$ÃtCjEP(SFjEP1IQSu SFEPFe[^_ÍvUWVS}}W u4v<$F|ѡXPu_u. XC| Au_tKSs&{u{F>tv<}tCuuG5HhD}WhZ5HC5HhWD5HC sxCPV}Wރ cv5HhdDP}Wh5HlC5HhWEu WU:uuURxvURWzURuURURWt&x . PW@juƃ|r]hURU:t$RURSuURzSUR0~URSuURU:uuURURWUR>FWURe[^_ÍvUS]M U$/u t&C<3/t4t05HhDT.%d ! No program text was specified. Writing the output file (%s): Writing the output files: (%s)w! Cannot open output file: (%s) Done.#define %smacro defs have strange char! This can't happen: /*%d:*//*:%d*/ #line %d "" pОН0pP0ПWWp`! Input ended in mid-comment! Section name ended in mid-comment! String didn't end! Input ended in middle of string ! String too long: ...! Use @l in limbo only! Double @ should be used in control text! Input ended in section name! Section name didn't end! Nesting of section names not allowed ! Section name too long: output files! Verbatim string didn't end! Double @ should be used in ASCII constant#########ЫT############v #############################################################! Missing `@ ' before a named section! Misplaced @h! Double @ should be used in string! Unrecognized escape sequence! @d, @f and @c are ignored in C texttextӵд*%d! Definition flushed, must start with identifier! Improper hex number following @l%x! Replacement string in @l too long! Double @ should be used in limbo Memory usage statistics: %ld names (out of %ld) %ld replacement texts (out of %ld) %ld bytes (out of %ld) %ld tokens (out of %ld) --version output version information and exit--help display this help and exit+s print usage statistics+e enclose C material in \PB{...}-x omit indices and table of contents-p suppress progress report messages-h suppress success message on completion-f do not force a newline after every C statement in output-b suppress banner line on terminal a null CHANGEFILE. unless otherwise specified by OUTFILE; in this case, '-' specifies TeX output goes to the basename of WEBFILE extended with `.tex' Default CHANGEFILE is /dev/null; Weave WEBFILE with CHANGEFILE into a TeX document.Usage: cweave [OPTIONS] WEBFILE[.w] [{CHANGEFILE[.ch]|-}] [OUTFILE[.tex]] C output goes to the basename of WEBFILE extended with `.c' Tangle WEBFILE with CHANGEFILE into a C/C++ program.Usage: ctangle [OPTIONS] WEBFILE[.w] [{CHANGEFILE[.ch]|-}] [OUTFILE[.c]]cwebw! Cannot open output file ! Input line too long! Missing @x in change file! Change file ended after @x! Change file ended before @y! Where is the matching @y? ! Hmm... %d of the preceding lines failed to match! CWEB file ended during a changer! Cannot open input file ! Cannot open change file ! Change file ended without @z! Where is the matching @z?! Include file name not given! Too many nested includes! Include file name too long! Cannot open include file! Change file entry did not matchbyte memoryname... ! Ambiguous prefix: matches <> and <> ! New name is a prefix of < ! New name extends < ! Section name incompatible with <>, which abbreviates < %s%s. (l. %d of change file) . (l. %d) . (l. %d of include file %s) (No errors were found.) (Did you see the warning message above?) (Pardon me, but I think I spotted something wrong.) (That was a fatal error, my friend.) ! Sorry, %s capacity exceeded-help--help-version--versionSilvio Levy and Donald E. KnuthThis is CTANGLE, Version 3.64This is CWEAVE, Version 3.64%uctangle: Need one to three file arguments. ctanglecweave: Need one to three file arguments. cweave! Filename too long %s.w%s.tex%s.idx%s.scn%s.c-%s.ch/dev/nullprintversionandexitprintversion.cprog_name_end && prog_version%s %s%s Copyright 2005 %s. Kpathsea is copyright 2005 Karl Berry and Olaf Weber.There is NO warranty. Redistribution of this software iscovered by the terms of both the %s copyright and the Lesser GNU General Public License.For more information about these matters, see the filenamed COPYING and the %s source. Primary author of %s: %s. Kpathsea written by Karl Berry, Olaf Weber, and others. Try `%s --help' for more information. tex-k@mail.tug.org%s Email bug reports to %s. (Web2C 7.5.5)TEXSIZESwarning: kpathsea: last resort size %s not in ascending order, ignored. pkmftextfmofmocp._compile-time paths.htexmf.cnfprogram config file environment variableapplication override variablegfTEXFONTSGLYPHFONTSGFFONTS.:/usr/TeX/texmf/fonts/gf/$MAKETEX_MODE//$KPATHSEA_DPI--dpi$MAKETEX_MAG--mag$MAKETEX_BASE_DPI--bdpi$MAKETEX_MODE--mfmodemktexpkTEXPKSPKFONTS.:{/usr/TeX/texmf/fonts,/var/tmp/texfonts}/pk/{$MAKETEX_MODE,modeless}//bitmap font.:/usr/TeX/texmf/fontsmktextfmTFMFONTS.:{/usr/TeX/texmf/fonts,/var/tmp/texfonts}/tfm//.tfmafmAFMFONTS.:/usr/TeX/texmf/fonts/afm//.afmmktexfmtbaseTEXMFINIMFBASES.:/usr/TeX/texmf/web2c.basebibTEXBIBBIBINPUTS.:/usr/TeX/texmf/bibtex/bib//.bibbstBSTINPUTS.:/usr/TeX/texmf/bibtex/bst//.bstcnfTEXMFCNF{$SELFAUTOLOC,$SELFAUTODIR,$SELFAUTOPARENT}{,{/share,}/texmf{-local,}/web2c}:$TETEXDIR:/usr/TeX/texmf/web2c:/usr/TeX/texmf/web2c.cnfls-RTEXMFDBS/usr/TeX/texmf:/var/tmp/texfontsls-rfmtTEXFORMATS.fmt.afmt.xpf.xpfmt.epf.epfmt.pfm.pfmt.eof.eoft.eofmt.oft.ofm.ofmt.efm.efmtmapTEXFONTMAPS.:/usr/TeX/texmf/fonts/map//.mapmemMPMEMS.memmktexmfMFINPUTS.:/usr/TeX/texmf/metafont//:{/usr/TeX/texmf/fonts,/var/tmp/texfonts}/source//.mfmftMFTINPUTS.:/usr/TeX/texmf/mft//.mftmfpoolMFPOOL.poolmpMPINPUTS.:/usr/TeX/texmf/metapost//.mpmppoolMPPOOLMetaPost supportMPSUPPORT.:/usr/TeX/texmf/metapost/supportmkocpOCPINPUTS.:/usr/TeX/texmf/omega/ocp//.ocpmkofmOFMFONTS.:{/usr/TeX/texmf/fonts,/var/tmp/texfonts}/{ofm,tfm}//:$TFMFONTSoplOPLFONTS.:{/usr/TeX/texmf/fonts,/var/tmp/texfonts}/opl//.oplotpOTPINPUTS.:/usr/TeX/texmf/omega/otp//.otpovfOVFFONTS.:{/usr/TeX/texmf/fonts,/var/tmp/texfonts}/ovf//.ovfovpOVPFONTS.:{/usr/TeX/texmf/fonts,/var/tmp/texfonts}/ovp//.ovpgraphic/figureTEXINPUTSTEXPICTS.:/usr/TeX/texmf/tex/{$progname,generic,}//.epsi.epsmktextex.texPostScript headerPSHEADERSTEXPSHEADERS.:/usr/TeX/texmf/{dvips,fonts/{enc,type1,type3}}//.proTeX system documentationTEXDOCS.:/usr/TeX/texmf/doc//texpoolTEXPOOLTeX system sourcesTEXSOURCES.:/usr/TeX/texmf/source//Troff fontsTRFONTS/usr/share/groff/current/font/devpstype1 fontsT1INPUTST1FONTS.:/usr/TeX/texmf/fonts/type1//.pfb.pfavfVFFONTS.:/usr/TeX/texmf/fonts/vf//.vfdvips configTEXCONFIG/usr/TeX/texmf/dvips//istINDEXSTYLETEXINDEXSTYLE.:/usr/TeX/texmf/makeindex//.isttruetype fontsTTFONTS.:/usr/TeX/texmf/fonts/truetype//.TTC.TTF.ttc.ttftype42 fontsT42FONTS.:/usr/TeX/texmf/fonts/type42//web2c filesWEB2C/usr/TeX/texmf/web2cother text filesINPUTS//$TEXMF/:other binary filesmisc fontsMISCFONTS.:/usr/TeX/texmf/fonts/misc//webWEBINPUTS.:/usr/TeX/texmf/web//.web.chcwebCWEBINPUTS.:/usr/TeX/texmf/cweb//.wenc filesENCFONTS.:/usr/TeX/texmf/fonts/enc//.enccmap filesCMAPFONTS.:/usr/TeX/texmf/fonts/cmap//.cmapsubfont definition filesSFDFONTS.:/usr/TeX/texmf/fonts/sfd//.sfdopentype fontsOPENTYPEFONTS.:/usr/TeX/texmf/fonts/opentype//.otfpdftex configPDFTEXCONFIG.:/usr/TeX/texmf/pdftex/{$progname,}//lig filesLIGFONTS.:/usr/TeX/texmf/fonts/lig//.ligtexmfscriptsTEXMFSCRIPTS/usr/TeX/texmf/scripts//%s: fatal: kpse_init_format: Unknown format %dkdebug:Search path for %s files (from %s) = %s before expansion = %s (none) application override path = %s application config file path = %s texmf.cnf path = %s compile-time path = %s default suffixes = %s (none) other suffixes = search only with suffix = %d numeric format value = %d runtime generation program = %s runtime generation command = program enabled = %d program enable level = %d 0uba `$`fPD0U0U"G `0p"ckpse_find_filetex-file.cnamekpse_find_file: searching for %s of type %s (from %s) rbr%s file `%s' not foundkpse_reset_program_nameprogname && kpse_program_nameprogname.texmf.cnfrwarning: %s: Last line ends with \. kpse_cnf_getcnf.ckpse_program_namels-rls-Rrwarning: kpathsea: No usable entries in %s. kpathsea: See the manual for how to generate ls-Rkdebug:%s: %u entries in %d directories (%d hidden). ls-R hash table:%s: %u aliases. alias hash table:aliases/db:match(%s,%s) = %d kdebug:fopen(%s, %s) => 0x%lx fclose(0x%lx) => %d KPSE_DOT:/warning: %s: Unmatched {. r@cincludewarning: %s:%u: Filename argument for include directive missing. %s:%u: Can't find fontname include file `%s'%s:%u: Fontname alias missing for filename `%s'texfonts.mapkdebug:hash_lookup(%s) => (nil) %ld%4d :%-5d %s=>%s%u buckets, %u nonempty (%u%%); %u entries, average chain %.1f. kpse_expand_defaultkdefault.cfallbackelementpath-elt.cpathTEXMFLOGa%lu %s kdebug:start search(file=%s, must_exist=%d, find_all=%d, path=%s). search(%s) =>start search(files=[%s], must_exist=%d, find_all=%d, path=%s). search([%s]) =>rlstat(%s) failed ... /[%s]%s%s -> [%s]%s%s %s%s[%s]%s%s%s -> %s%s[%s]%s%s .../..%s == %s%s%s%s%s %s == %s%s%s PATHKPATHSEA_DEBUGSELFAUTOLOCSELFAUTODIRSELFAUTOPARENTexeprognamereadableTEX_HUSHallnoneKPATHSEA_DPIMAKETEX_BASE_DPIset_maketex_magtex-make.cdpi != 0 && bdpi != 0%u+%u/%u%u+%u/(%u*%u + %u)%u+%u/(%u*%u)%u+%u/(4000 + %u)-magstep\(%s%d.%d\)MAKETEX_MAGMISSFONT_LOGmissfont.logaTEXMFOUTPUT/kpathsea: Appending font creation commands to %s. kpathsea: Running %s/dev/nullkpathsea: open("/dev/null", O_RDONLY)kpathsea: pipe()kpathsea: open("/dev/null", O_WRONLY)kpathsea: fork()kpathsea: read()warning: kpathsea: %s output `%s' instead of a filename. kpathsea: Illegal fontname `%s': starts with '%c' kpathsea: Illegal fontname `%s': contains '%c' kpse_tilde_expandtilde.cname!!HOME.kpse_var_valuevariable.ckpse_program_name._kdebug:(nil)variable: %s = %s warning: kpathsea: variable `%s' references itself (eventually). %s: No matching } for ${%s: Unrecognized variable construct `$%c'kpathsea version 3.5.5Email bug reports to tex-k@mail.tug.org. xfopenxfopen.cfilename && mode%s: xfclosefgetcwd: %sfatal: memory exhausted (xmalloc of %u bytes). =%s: fatal: putenv(%s). %dfatal: memory exhausted (realloc of %u bytes). /do_subdirelt-dirs.c((elt[elt_length - 1]) == '/') || 0kdebug:kpse_normalize_path (%s) => %u path element %s => %s.fn_freefn.c((*f).str) != ((void *)0)fn_shrink_to((*f).length) > loct?ǘ@333333??%s: %s: fatal: closedir failed. kdebug:dir_links(%s) => %ld x9O\ (@hhg`ggfff@ffee@eedd ihghgffffeeddB      yqʍڍ *:JZjzʎڎ *:JZjzʏڏ *:JZjzʐڐ * d Y(ȇX  \@o oo~GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((07 XXp?ȇGo~~ To  Pc \\ l dd 8u   ~dd / @@\YY5 LL0||@@ @  $#